PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004624
Common NameRCOM_1079400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 203aa    MW: 22790.4 Da    PI: 9.4591
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004624genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.27.3e-33124182159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+
  29929.m004624 124 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTRDEGIVVTTYEGMHSHP 182
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-34109182IPR003657WRKY domain
SuperFamilySSF1182901.15E-29116183IPR003657WRKY domain
PROSITE profilePS5081130.136119184IPR003657WRKY domain
SMARTSM007749.2E-39124183IPR003657WRKY domain
PfamPF031061.8E-26125182IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MENYPSFFPF SSSSSSSSSS SETASAASCS SMSLNIMGSS SINGFTDYFQ ANKENGLLGL  60
VQEMEVPMGL SNGHSNNLSQ NKSFGGFGSE NNEEKLLSSG KKKGEKKMKK PRYAFQTRSQ  120
VDILDDGYRW RKYGQKAVKN NKFPRSYYRC THQGCNVKKQ VQRLTRDEGI VVTTYEGMHS  180
HPIEKSTDNF EHILSQMQIY TSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-28114181774Probable WRKY transcription factor 4
1wj2_A2e-28114181774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9146501e-111JQ914650.1 Hevea brasiliensis WRKY super family protein (WRKY6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514888.21e-128PREDICTED: probable WRKY transcription factor 75
TrEMBLB9RMB91e-151B9RMB9_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0003s16750.19e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-59WRKY DNA-binding protein 75